General Information

  • ID:  hor005455
  • Uniprot ID:  P67806
  • Protein name:  Accessory gland-specific peptide 70A
  • Gene name:  Acp70A
  • Organism:  Drosophila mauritiana (Fruit fly)
  • Family:  NA
  • Source:  animal
  • Expression:  Main cells of the accessory glands of males (paragonial gland).
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007610 behavior; GO:0046008 regulation of female receptivity, post-mating
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  WEWPWNRKPTKYPIPSPNPRDKWCRLNLGPAWGGRC
  • Length:  36
  • Propeptide:  MKTLSLFLVLVCLLGLVQSWEWPWNRKPTKYPIPSPNPRDKWCRLNLGPAWGGRC
  • Signal peptide:  MKTLSLFLVLVCLLGLVQS
  • Modification:  T9 Hydroxyproline;T13 Hydroxyproline;T15 Hydroxyproline;T19 Hydroxyproline
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Represses female sexual receptivity and stimulates oviposition.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  24-36
  • Structure ID:  AF-P67806-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005455_AF2.pdbhor005455_ESM.pdb

Physical Information

Mass: 498848 Formula: C202H293N59O47S2
Absent amino acids: FHMQV Common amino acids: P
pI: 10.62 Basic residues: 7
Polar residues: 11 Hydrophobic residues: 9
Hydrophobicity: -133.33 Boman Index: -8429
Half-Life: 2.8 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 35.28
Instability Index: 2690.83 Extinction Coefficient cystines: 29115
Absorbance 280nm: 831.86

Literature

  • PubMed ID:  9286679
  • Title:  Evolutionary history of the sex-peptide (Acp70A) gene region in Drosophila melanogaster.